PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011082696.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family SBP
Protein Properties Length: 198aa    MW: 22822.5 Da    PI: 6.5073
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011082696.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.75e-4182158177
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     +C ve+Ceadls +k+yh+rh+vCevh+kapvvlv+gl+qrfCqqCsrfhelsefD++krsCrrrLa+hnerrrk++
  XP_011082696.1  82 CCLVENCEADLSCCKKYHQRHRVCEVHAKAPVVLVDGLRQRFCQQCSRFHELSEFDQTKRSCRRRLAGHNERRRKSS 158
                     6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.6E-3279144IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.40280157IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-3781161IPR004333Transcription factor, SBP-box
PfamPF031101.5E-3183156IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MNPDMQNMMS SYLKIKKLVQ DEEEEEEEEE DDDEDEEEKD MEIEVKFAES QLKKKKLSLG  60
EGSGKVTGKA VAGGVAVVAS PCCLVENCEA DLSCCKKYHQ RHRVCEVHAK APVVLVDGLR  120
QRFCQQCSRF HELSEFDQTK RSCRRRLAGH NERRRKSSLE SRREGSNRRL VENQFRQLNE  180
RPDLSSPGSQ NFHIHSSH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-32831561184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00359DAPTransfer from AT3G15270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0666093e-60KJ066609.1 Sesamum indicum clone TilSSR_37810 microsatellite Sesame_37810 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082696.11e-143PREDICTED: squamosa promoter-binding protein 2-like
SwissprotQ387404e-69SBP2_ANTMA; Squamosa promoter-binding protein 2
TrEMBLI2FJZ15e-52I2FJZ1_9LAMI; SBP-box protein
STRINGPOPTR_0001s40870.11e-44(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.13e-33squamosa promoter binding protein-like 5